MESD Antibody (Biotin)

Catalog number KB-8021-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8021-01

Size / count 50 μL

Specifications

Catalog number: KB-8021-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: LRP chaperone MESD, LDLR chaperone MESD, Mesoderm development LRP chaperone MESD, Mesoderm development candidate 2, Mesoderm development protein, Renal carcinoma antigen NY-REN-61
Gene Name: MESD
Gene ID: 23184
UniProt: Q14696
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MESD
Target: PP-852
Partner Proteins: LRP chaperone MESD; LDLR chaperone MESD; Mesoderm development LRP chaperone MESD; Mesoderm development candidate 2; Mesoderm development protein; Renal carcinoma antigen NY-REN-61
Clone: K29060_3C5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 88%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0081; MESDC2; MESDM
Target Alternative Name: MESD
Host or Source: Mouse
Protein Name: Mesoderm development LRP chaperone
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for MESD Antibody (Biotin)?

The catalog number for MESD Antibody (Biotin) is KB-8021.

What sizes are available for MESD Antibody (Biotin)?

MESD Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MESD Antibody (Biotin) come in?

MESD Antibody (Biotin) is available in 3 different pack sizes.

Is MESD Antibody (Biotin) in stock?

MESD Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.