NEDD9 Antibody (Biotin)

Catalog number KB-1752-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1752-01

Size / count 50 μL

Specifications

Catalog number: KB-1752-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Enhancer of filamentation 1, hEF1, CRK-associated substrate-related protein, CAS-L, CasL, Cas scaffolding protein family member 2, CASS2, Neural precursor cell expressed developmentally down-regulated protein 9, NEDD-9, Renal carcinoma antigen NY-REN-12, p105) [Cleaved into: Enhancer of filamentation 1 p55]
Gene Name: NEDD9
Gene ID: 4739
UniProt: Q14511
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NEDD9
Target: PP-851
Partner Proteins: Enhancer of filamentation 1; hEF1; CRK-associated substrate-related protein; CAS-L; CasL; Cas scaffolding protein family member 2; CASS2; Neural precursor cell expressed developmentally down-regulated protein 9; NEDD-9; Renal carcinoma antigen NY-REN-12; p105) [Cleaved into: Enhancer of filamentation 1 p55]
Clone: K70047_11E9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 44%, Pig - 86%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CASL
Target Alternative Name: NEDD9
Host or Source: Mouse
Protein Name: Neural precursor cell expressed, developmentally down-regulated 9, Neural precursor cell expressed, developmentally down-regulated 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for NEDD9 Antibody (Biotin)?

The catalog number for NEDD9 Antibody (Biotin) is KB-1752.

What sizes are available for NEDD9 Antibody (Biotin)?

NEDD9 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does NEDD9 Antibody (Biotin) come in?

NEDD9 Antibody (Biotin) is available in 3 different pack sizes.

Is NEDD9 Antibody (Biotin) in stock?

NEDD9 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.