Lysosome Membrane Protein 2 Antibody (Biotin)

Catalog number KB-7793-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7793-01

Size / count 50 μL

Specifications

Catalog number: KB-7793-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysosome membrane protein 2, 85 kDa lysosomal membrane sialoglycoprotein, LGP85, CD36 antigen-like 2, Lysosome membrane protein II, LIMP II, Scavenger receptor class B member 2, CD antigen CD36
Gene Name: SCARB2
Gene ID: 950
UniProt: Q14108
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SCARB2
Target Antigen: CD36
Target: PP-461
Partner Proteins: Lysosome membrane protein 2; 85 kDa lysosomal membrane sialoglycoprotein; LGP85; CD36 antigen-like 2; Lysosome membrane protein II; LIMP II; Scavenger receptor class B member 2; CD antigen CD36
Clone: K92051_6C9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 85%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CD36L2; LIMP2; LIMPII
Target Alternative Name: Lysosome Membrane Protein 2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Scavenger receptor class B member 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Lysosome Membrane Protein 2 Antibody (Biotin)?

The catalog number for Lysosome Membrane Protein 2 Antibody (Biotin) is KB-7793.

What sizes are available for Lysosome Membrane Protein 2 Antibody (Biotin)?

Lysosome Membrane Protein 2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Lysosome Membrane Protein 2 Antibody (Biotin) come in?

Lysosome Membrane Protein 2 Antibody (Biotin) is available in 3 different pack sizes.

Is Lysosome Membrane Protein 2 Antibody (Biotin) in stock?

Lysosome Membrane Protein 2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.