Lysosome Membrane Protein 2 Antibody (Biotin)

Catalog number KB-7790-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7790-01

Size / count 50 μL

Specifications

Catalog number: KB-7790-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysosome membrane protein 2, 85 kDa lysosomal membrane sialoglycoprotein, LGP85, CD36 antigen-like 2, Lysosome membrane protein II, LIMP II, Scavenger receptor class B member 2, CD antigen CD36
Gene Name: SCARB2
Gene ID: 950
UniProt: Q14108
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SCARB2
Target Antigen: CD36
Target: PP-461
Partner Proteins: Lysosome membrane protein 2; 85 kDa lysosomal membrane sialoglycoprotein; LGP85; CD36 antigen-like 2; Lysosome membrane protein II; LIMP II; Scavenger receptor class B member 2; CD antigen CD36
Clone: K92051_20E1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 85%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CD36L2; LIMP2; LIMPII
Target Alternative Name: Lysosome Membrane Protein 2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Scavenger receptor class B member 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Lysosome Membrane Protein 2 Antibody (Biotin)?

The catalog number for Lysosome Membrane Protein 2 Antibody (Biotin) is KB-7790.

What sizes are available for Lysosome Membrane Protein 2 Antibody (Biotin)?

Lysosome Membrane Protein 2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Lysosome Membrane Protein 2 Antibody (Biotin) come in?

Lysosome Membrane Protein 2 Antibody (Biotin) is available in 3 different pack sizes.

Is Lysosome Membrane Protein 2 Antibody (Biotin) in stock?

Lysosome Membrane Protein 2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.