Alpha Fodrin Antibody

Catalog number KC-30511-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-30511-01

Size / count 50 μL

Specifications

Catalog number: KC-30511-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Spectrin alpha chain, non-erythrocytic 1, Alpha-II spectrin, Fodrin alpha chain, Spectrin, non-erythroid alpha subunit
Gene Name: SPTAN1
Gene ID: 6709
UniProt: Q13813
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SPTAN1
Target: PP-5039
Partner Proteins: Spectrin alpha chain; non-erythrocytic 1; Alpha-II spectrin; Fodrin alpha chain; Spectrin; non-erythroid alpha subunit
Clone: K92088_2C5
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:3000~1:4000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NEAS; SPTA2
Target Alternative Name: Alpha Fodrin
Panel Description: Autoimmune Disease, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Spectrin alpha, non-erythrocytic 1
IHC description: Succeed
IP description: Fail (Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Alpha Fodrin Antibody?

The catalog number for Alpha Fodrin Antibody is KC-30511.

What sizes are available for Alpha Fodrin Antibody?

Alpha Fodrin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha Fodrin Antibody come in?

Alpha Fodrin Antibody is available in 3 different pack sizes.

Is Alpha Fodrin Antibody in stock?

Alpha Fodrin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

All Products