Alpha Fodrin Antibody

Catalog number KC-30540-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-30540-01

Size / count 50 μL

Specifications

Catalog number: KC-30540-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Spectrin alpha chain, non-erythrocytic 1, Alpha-II spectrin, Fodrin alpha chain, Spectrin, non-erythroid alpha subunit
Gene Name: SPTAN1
Gene ID: 6709
UniProt: Q13813
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human SPTAN1
Target: PP-5039
Partner Proteins: Spectrin alpha chain; non-erythrocytic 1; Alpha-II spectrin; Fodrin alpha chain; Spectrin; non-erythroid alpha subunit
Clone: K92088_9F2
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NEAS; SPTA2
Target Alternative Name: Alpha Fodrin
Panel Description: Autoimmune Disease, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Spectrin alpha, non-erythrocytic 1
WB Description: Succeed
IHC description: Fail (Kidney)
IP description: Fail (Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Alpha Fodrin Antibody?

The catalog number for Alpha Fodrin Antibody is KC-30540.

What sizes are available for Alpha Fodrin Antibody?

Alpha Fodrin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha Fodrin Antibody come in?

Alpha Fodrin Antibody is available in 3 different pack sizes.

Is Alpha Fodrin Antibody in stock?

Alpha Fodrin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products