Alpha Fodrin Antibody

Catalog number KC-30763-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-30763-01

Size / count 50 μL

Specifications

Catalog number: KC-30763-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Spectrin alpha chain, non-erythrocytic 1, Alpha-II spectrin, Fodrin alpha chain, Spectrin, non-erythroid alpha subunit
Gene Name: SPTAN1
Gene ID: 6709
UniProt: Q13813
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human SPTAN1
Target: PP-5039
Partner Proteins: Spectrin alpha chain; non-erythrocytic 1; Alpha-II spectrin; Fodrin alpha chain; Spectrin; non-erythroid alpha subunit
Clone: K92088_18G9
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NEAS; SPTA2
Target Alternative Name: Alpha Fodrin
Panel Description: Autoimmune Disease, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Spectrin alpha, non-erythrocytic 1
WB Description: Succeed
IHC description: Fail (Kidney)
IP description: Fail (Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Alpha Fodrin Antibody?

The catalog number for Alpha Fodrin Antibody is KC-30763.

What sizes are available for Alpha Fodrin Antibody?

Alpha Fodrin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha Fodrin Antibody come in?

Alpha Fodrin Antibody is available in 3 different pack sizes.

Is Alpha Fodrin Antibody in stock?

Alpha Fodrin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.