EIF4EBP1 Antibody (Biotin)

Catalog number KB-7615-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7615-01

Size / count 50 μL

Specifications

Catalog number: KB-7615-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Eukaryotic translation initiation factor 4E-binding protein 1, 4E-BP1, eIF4E-binding protein 1, Phosphorylated heat- and acid-stable protein regulated by insulin 1, PHAS-I
Gene Name: EIF4EBP1
Gene ID: 1978
UniProt: Q13541
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human EIF4EBP1
Target: PP-1455
Partner Proteins: Eukaryotic translation initiation factor 4E-binding protein 1; 4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I
Clone: K70031_1G10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 93%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: TLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: EIF4EBP1
Host or Source: Mouse
Protein Name: Eukaryotic translation initiation factor 4E binding protein 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for EIF4EBP1 Antibody (Biotin)?

The catalog number for EIF4EBP1 Antibody (Biotin) is KB-7615.

What sizes are available for EIF4EBP1 Antibody (Biotin)?

EIF4EBP1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does EIF4EBP1 Antibody (Biotin) come in?

EIF4EBP1 Antibody (Biotin) is available in 3 different pack sizes.

Is EIF4EBP1 Antibody (Biotin) in stock?

EIF4EBP1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.