EIF4EBP1 Antibody (Biotin)

Catalog number KB-1174-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1174-01

Size / count 50 μL

Specifications

Catalog number: KB-1174-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Eukaryotic translation initiation factor 4E-binding protein 1, 4E-BP1, eIF4E-binding protein 1, Phosphorylated heat- and acid-stable protein regulated by insulin 1, PHAS-I
Gene Name: EIF4EBP1
Gene ID: 1978
UniProt: Q13541
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human EIF4EBP1
Target: PP-1455
Partner Proteins: Eukaryotic translation initiation factor 4E-binding protein 1; 4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I
Clone: K70031_7C11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 93%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: TLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: EIF4EBP1
Host or Source: Mouse
Protein Name: Eukaryotic translation initiation factor 4E binding protein 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for EIF4EBP1 Antibody (Biotin)?

The catalog number for EIF4EBP1 Antibody (Biotin) is KB-1174.

What sizes are available for EIF4EBP1 Antibody (Biotin)?

EIF4EBP1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does EIF4EBP1 Antibody (Biotin) come in?

EIF4EBP1 Antibody (Biotin) is available in 3 different pack sizes.

Is EIF4EBP1 Antibody (Biotin) in stock?

EIF4EBP1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.