FKBP5 Antibody (Biotin)

Catalog number KB-11427-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-11427-01

Size / count 50 μL

Specifications

Catalog number: KB-11427-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Peptidyl-prolyl cis-trans isomerase FKBP5, PPIase FKBP5, 51 kDa FK506-binding protein, 51 kDa FKBP, FKBP-51, 54 kDa progesterone receptor-associated immunophilin, Androgen-regulated protein 6, FF1 antigen, FK506-binding protein 5, FKBP-5, FKBP54, p54, HSP90-binding immunophilin, Rotamase
Gene Name: FKBP5
Gene ID: 2289
UniProt: Q13451
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FKBP5
Target: PP-840
Partner Proteins: Peptidyl-prolyl cis-trans isomerase FKBP5; PPIase FKBP5; 51 kDa FK506-binding protein; 51 kDa FKBP; FKBP-51; 54 kDa progesterone receptor-associated immunophilin; Androgen-regulated protein 6; FF1 antigen; FK506-binding protein 5; FKBP-5; FKBP54; p54; HSP90-binding immunophilin; Rotamase
Clone: K52044_3C7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 54%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: DLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: AIG6; FKBP51
Target Alternative Name: FKBP5
Host or Source: Mouse
Protein Name: FKBP prolyl isomerase 5
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for FKBP5 Antibody (Biotin)?

The catalog number for FKBP5 Antibody (Biotin) is KB-11427.

What sizes are available for FKBP5 Antibody (Biotin)?

FKBP5 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does FKBP5 Antibody (Biotin) come in?

FKBP5 Antibody (Biotin) is available in 3 different pack sizes.

Is FKBP5 Antibody (Biotin) in stock?

FKBP5 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.