MFAP5 Antibody (Biotin)

Catalog number KB-3672-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3672-01

Size / count 50 μL

Specifications

Catalog number: KB-3672-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Microfibrillar-associated protein 5, MFAP-5, MP25, Microfibril-associated glycoprotein 2, MAGP-2
Gene Name: MFAP5
Gene ID: 8076
UniProt: Q13361
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MFAP5
Target: PP-1298
Partner Proteins: Microfibrillar-associated protein 5; MFAP-5; MP25; Microfibril-associated glycoprotein 2; MAGP-2
Clone: K52021_12G12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Pig - 79%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: GDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MAGP2
Target Alternative Name: MFAP5
Host or Source: Mouse
Protein Name: Microfibril associated protein 5
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for MFAP5 Antibody (Biotin)?

The catalog number for MFAP5 Antibody (Biotin) is KB-3672.

What sizes are available for MFAP5 Antibody (Biotin)?

MFAP5 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MFAP5 Antibody (Biotin) come in?

MFAP5 Antibody (Biotin) is available in 3 different pack sizes.

Is MFAP5 Antibody (Biotin) in stock?

MFAP5 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.