BIK Antibody (Biotin)

Catalog number KB-7434-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7434-01

Size / count 50 μL

Specifications

Catalog number: KB-7434-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Bcl-2-interacting killer, Apoptosis inducer NBK, BIP1, BP4
Gene Name: BIK
Gene ID: 638
UniProt: Q13323
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BIK
Target: PP-3198
Partner Proteins: Bcl-2-interacting killer; Apoptosis inducer NBK; BIP1; BP4
Clone: K1E051_5A7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 41%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: ILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 41%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NBK
Target Alternative Name: BIK
Host or Source: Mouse
Protein Name: BCL2 interacting killer
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for BIK Antibody (Biotin)?

The catalog number for BIK Antibody (Biotin) is KB-7434.

What sizes are available for BIK Antibody (Biotin)?

BIK Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does BIK Antibody (Biotin) come in?

BIK Antibody (Biotin) is available in 3 different pack sizes.

Is BIK Antibody (Biotin) in stock?

BIK Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

All Products