Recombinant SEMA3F Antibody

Catalog number RN-8589-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-8589-01

Size / count 50 μL

Specifications

Catalog number: RN-8589-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Semaphorin-3F, Sema III/F, Semaphorin IV, Sema IV
Gene Name: SEMA3F
Gene ID: 6405
UniProt: Q13275
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SEMA3F
Target: PP-1603
Partner Proteins: Semaphorin-3F; Sema III/F; Semaphorin IV; Sema IV
Clone: K24056_17H12
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 93%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: AVHAALFPPLSMSAPPPPGAGPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SEMA3F
Host or Source: Mouse
Protein Name: Semaphorin 3F
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SEMA3F Antibody?

The catalog number for Recombinant SEMA3F Antibody is RN-8589.

What sizes are available for Recombinant SEMA3F Antibody?

Recombinant SEMA3F Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SEMA3F Antibody come in?

Recombinant SEMA3F Antibody is available in 3 different pack sizes.

Is Recombinant SEMA3F Antibody in stock?

Recombinant SEMA3F Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

All Products