KAP1 Antibody (Biotin)

Catalog number KB-8469-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8469-01

Size / count 50 μL

Specifications

Catalog number: KB-8469-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcription intermediary factor 1-beta, TIF1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KAP-1, KRAB-interacting protein 1, KRIP-1, Nuclear corepressor KAP-1, RING finger protein 96, RING-type E3 ubiquitin transferase TIF1-beta, Tripartite motif-containing protein 28
Gene Name: TRIM28
Gene ID: 10155
UniProt: Q13263
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TRIM28
Target: PP-5021
Partner Proteins: Transcription intermediary factor 1-beta; TIF1-beta; E3 SUMO-protein ligase TRIM28; KRAB-associated protein 1; KAP-1; KRAB-interacting protein 1; KRIP-1; Nuclear corepressor KAP-1; RING finger protein 96; RING-type E3 ubiquitin transferase TIF1-beta; Tripartite motif-containing protein 28
Clone: K56042_3E12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: CQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KAP1; RNF96; TIF1B
Target Alternative Name: KAP1
Panel Description: E3 Ligase, DNA binding & Chromatin, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Tripartite motif containing 28
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for KAP1 Antibody (Biotin)?

The catalog number for KAP1 Antibody (Biotin) is KB-8469.

What sizes are available for KAP1 Antibody (Biotin)?

KAP1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does KAP1 Antibody (Biotin) come in?

KAP1 Antibody (Biotin) is available in 3 different pack sizes.

Is KAP1 Antibody (Biotin) in stock?

KAP1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.