Recombinant KAP1 Antibody

Catalog number RN-12555-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12555-01

Size / count 50 μL

Specifications

Catalog number: RN-12555-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcription intermediary factor 1-beta, TIF1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KAP-1, KRAB-interacting protein 1, KRIP-1, Nuclear corepressor KAP-1, RING finger protein 96, RING-type E3 ubiquitin transferase TIF1-beta, Tripartite motif-containing protein 28
Gene Name: TRIM28
Gene ID: 10155
UniProt: Q13263
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TRIM28
Target: PP-5021
Partner Proteins: Transcription intermediary factor 1-beta; TIF1-beta; E3 SUMO-protein ligase TRIM28; KRAB-associated protein 1; KAP-1; KRAB-interacting protein 1; KRIP-1; Nuclear corepressor KAP-1; RING finger protein 96; RING-type E3 ubiquitin transferase TIF1-beta; Tripartite motif-containing protein 28
Clone: K56042_3D12
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: CQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KAP1; RNF96; TIF1B
Target Alternative Name: KAP1
Panel Description: E3 Ligase, DNA binding & Chromatin, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Tripartite motif containing 28
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant KAP1 Antibody?

The catalog number for Recombinant KAP1 Antibody is RN-12555.

What sizes are available for Recombinant KAP1 Antibody?

Recombinant KAP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant KAP1 Antibody come in?

Recombinant KAP1 Antibody is available in 3 different pack sizes.

Is Recombinant KAP1 Antibody in stock?

Recombinant KAP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.