AMPK alpha 1 Antibody

Catalog number KC-20699-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-20699-01

Size / count 50 μL

Specifications

Catalog number: KC-20699-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK subunit alpha-1, Acetyl-CoA carboxylase kinase, ACACA kinase, Hydroxymethylglutaryl-CoA reductase kinase, HMGCR kinase, Tau-protein kinase PRKAA1
Gene Name: PRKAA1
Gene ID: 5562
UniProt: Q13131
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKAA1
Target: PP-1416
Partner Proteins: 5'-AMP-activated protein kinase catalytic subunit alpha-1; AMPK subunit alpha-1; Acetyl-CoA carboxylase kinase; ACACA kinase; Hydroxymethylglutaryl-CoA reductase kinase; HMGCR kinase; Tau-protein kinase PRKAA1
Clone: K29067_14E7
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AMPK1
Target Alternative Name: AMPK alpha 1
Panel Description: DNA binding & Chromatin, Ferroptosis
Host or Source: Mouse
Protein Name: Protein kinase AMP-activated catalytic subunit alpha 1
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for AMPK alpha 1 Antibody?

The catalog number for AMPK alpha 1 Antibody is KC-20699.

What sizes are available for AMPK alpha 1 Antibody?

AMPK alpha 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does AMPK alpha 1 Antibody come in?

AMPK alpha 1 Antibody is available in 3 different pack sizes.

Is AMPK alpha 1 Antibody in stock?

AMPK alpha 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.