Recombinant AMPK alpha 1 Antibody

Catalog number RN-10567-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-10567-01

Size / count 50 μL

Specifications

Catalog number: RN-10567-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK subunit alpha-1, Acetyl-CoA carboxylase kinase, ACACA kinase, Hydroxymethylglutaryl-CoA reductase kinase, HMGCR kinase, Tau-protein kinase PRKAA1
Gene Name: PRKAA1
Gene ID: 5562
UniProt: Q13131
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKAA1
Target: PP-1416
Partner Proteins: 5'-AMP-activated protein kinase catalytic subunit alpha-1; AMPK subunit alpha-1; Acetyl-CoA carboxylase kinase; ACACA kinase; Hydroxymethylglutaryl-CoA reductase kinase; HMGCR kinase; Tau-protein kinase PRKAA1
Clone: K29067_20C7
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AMPK1
Target Alternative Name: AMPK alpha 1
Panel Description: DNA binding & Chromatin, Ferroptosis
Host or Source: Mouse
Protein Name: Protein kinase AMP-activated catalytic subunit alpha 1
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant AMPK alpha 1 Antibody?

The catalog number for Recombinant AMPK alpha 1 Antibody is RN-10567.

What sizes are available for Recombinant AMPK alpha 1 Antibody?

Recombinant AMPK alpha 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant AMPK alpha 1 Antibody come in?

Recombinant AMPK alpha 1 Antibody is available in 3 different pack sizes.

Is Recombinant AMPK alpha 1 Antibody in stock?

Recombinant AMPK alpha 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.