Recombinant STK4 Antibody

Catalog number RN-13650-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13650-01

Size / count 50 μL

Specifications

Catalog number: RN-13650-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Serine/threonine-protein kinase 4, Mammalian STE20-like protein kinase 1, MST-1, STE20-like kinase MST1, Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit, MST1/N, Serine/threonine-protein kinase 4 18kDa subunit, MST1/C]
Gene Name: STK4
Gene ID: 6789
UniProt: Q13043
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human STK4
Target: PP-412
Partner Proteins: Serine/threonine-protein kinase 4; Mammalian STE20-like protein kinase 1; MST-1; STE20-like kinase MST1; Serine/threonine-protein kinase Krs-2) [Cleaved into: Serine/threonine-protein kinase 4 37kDa subunit; MST1/N; Serine/threonine-protein kinase 4 18kDa subunit; MST1/C]
Clone: K24065_1D6
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 56%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KRS2; MST1
Target Alternative Name: STK4
Host or Source: Mouse
Protein Name: Serine/threonine kinase 4
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant STK4 Antibody?

The catalog number for Recombinant STK4 Antibody is RN-13650.

What sizes are available for Recombinant STK4 Antibody?

Recombinant STK4 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant STK4 Antibody come in?

Recombinant STK4 Antibody is available in 3 different pack sizes.

Is Recombinant STK4 Antibody in stock?

Recombinant STK4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products