APC6 Antibody (Biotin)

Catalog number KB-28049-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-28049-01

Size / count 50 μL

Specifications

Catalog number: KB-28049-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cell division cycle protein 16 homolog, Anaphase-promoting complex subunit 6, APC6, CDC16 homolog, CDC16Hs, Cyclosome subunit 6
Gene Name: CDC16
Gene ID: 8881
UniProt: Q13042
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CDC16
Target: PP-7682
Partner Proteins: Cell division cycle protein 16 homolog; Anaphase-promoting complex subunit 6; APC6; CDC16 homolog; CDC16Hs; Cyclosome subunit 6
Clone: K1H019_14C9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ANAPC6
Target Alternative Name: APC6
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Cell division cycle 16
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for APC6 Antibody (Biotin)?

The catalog number for APC6 Antibody (Biotin) is KB-28049.

What sizes are available for APC6 Antibody (Biotin)?

APC6 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does APC6 Antibody (Biotin) come in?

APC6 Antibody (Biotin) is available in 3 different pack sizes.

Is APC6 Antibody (Biotin) in stock?

APC6 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

All Products