Recombinant APC6 Antibody

Catalog number RN-12053-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12053-01

Size / count 50 μL

Specifications

Catalog number: RN-12053-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cell division cycle protein 16 homolog, Anaphase-promoting complex subunit 6, APC6, CDC16 homolog, CDC16Hs, Cyclosome subunit 6
Gene Name: CDC16
Gene ID: 8881
UniProt: Q13042
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CDC16
Target: PP-7682
Partner Proteins: Cell division cycle protein 16 homolog; Anaphase-promoting complex subunit 6; APC6; CDC16 homolog; CDC16Hs; Cyclosome subunit 6
Clone: K1H019_11B5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Yes
WB Dilution: 1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ANAPC6
Target Alternative Name: APC6
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Cell division cycle 16
WB Description: Succeed
IP description: Fail (A549)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant APC6 Antibody?

The catalog number for Recombinant APC6 Antibody is RN-12053.

What sizes are available for Recombinant APC6 Antibody?

Recombinant APC6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant APC6 Antibody come in?

Recombinant APC6 Antibody is available in 3 different pack sizes.

Is Recombinant APC6 Antibody in stock?

Recombinant APC6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.