PDE4D Antibody (Biotin)

Catalog number KB-3187-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3187-01

Size / count 50 μL

Specifications

Catalog number: KB-3187-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CAMP-specific 3', 5'-cyclic phosphodiesterase 4D, DPDE3, PDE43
Gene Name: PDE4D
Gene ID: 5144
UniProt: Q08499
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PDE4D
Target: PP-4483
Partner Proteins: CAMP-specific 3'; 5'-cyclic phosphodiesterase 4D; DPDE3; PDE43
Clone: K92054_12C11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DPDE3
Target Alternative Name: PDE4D
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Phosphodiesterase 4D
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for PDE4D Antibody (Biotin)?

The catalog number for PDE4D Antibody (Biotin) is KB-3187.

What sizes are available for PDE4D Antibody (Biotin)?

PDE4D Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PDE4D Antibody (Biotin) come in?

PDE4D Antibody (Biotin) is available in 3 different pack sizes.

Is PDE4D Antibody (Biotin) in stock?

PDE4D Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.