PRKCQ Antibody (Biotin)

Catalog number KB-3506-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3506-01

Size / count 50 μL

Specifications

Catalog number: KB-3506-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C theta type, nPKC-theta
Gene Name: PRKCQ
Gene ID: 5588
UniProt: Q04759
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKCQ
Target: PP-3225
Partner Proteins: Protein kinase C theta type; nPKC-theta
Clone: K92052_10C11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 98%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: GQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: PRKCT
Target Alternative Name: PRKCQ
Host or Source: Mouse
Protein Name: Protein kinase C theta
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PRKCQ Antibody (Biotin)?

The catalog number for PRKCQ Antibody (Biotin) is KB-3506.

What sizes are available for PRKCQ Antibody (Biotin)?

PRKCQ Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PRKCQ Antibody (Biotin) come in?

PRKCQ Antibody (Biotin) is available in 3 different pack sizes.

Is PRKCQ Antibody (Biotin) in stock?

PRKCQ Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.