ACY1 Antibody (Biotin)

Catalog number KB-21307-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-21307-01

Size / count 50 μL

Specifications

Catalog number: KB-21307-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Aminoacylase-1, ACY-1, N-acyl-L-amino-acid amidohydrolase
Gene Name: ACY1
Gene ID: 95
UniProt: Q03154
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ACY1
Target: P02271PAD
Partner Proteins: Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase
Clone: K56037_16B8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 96%, Pig - 89%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: GHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ACY1
Host or Source: Mouse
Protein Name: Aminoacylase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for ACY1 Antibody (Biotin)?

The catalog number for ACY1 Antibody (Biotin) is KB-21307.

What sizes are available for ACY1 Antibody (Biotin)?

ACY1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ACY1 Antibody (Biotin) come in?

ACY1 Antibody (Biotin) is available in 3 different pack sizes.

Is ACY1 Antibody (Biotin) in stock?

ACY1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.