IRF9 Antibody (Biotin)

Catalog number KB-3695-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3695-01

Size / count 50 μL

Specifications

Catalog number: KB-3695-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon regulatory factor 9, IRF-9, IFN-alpha-responsive transcription factor subunit, ISGF3 p48 subunit, Interferon-stimulated gene factor 3 gamma, ISGF-3 gamma, Transcriptional regulator ISGF3 subunit gamma
Gene Name: IRF9
Gene ID: 10379
UniProt: Q00978
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IRF9
Target: PP-2126
Partner Proteins: Interferon regulatory factor 9; IRF-9; IFN-alpha-responsive transcription factor subunit; ISGF3 p48 subunit; Interferon-stimulated gene factor 3 gamma; ISGF-3 gamma; Transcriptional regulator ISGF3 subunit gamma
Clone: K70047_7G2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 33%, Pig - 73%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: REDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ISGF3G
Target Alternative Name: IRF9
Panel Description: DNA binding & Chromatin, Ferroptosis, Transcription Factors
Host or Source: Mouse
Protein Name: Interferon regulatory factor 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for IRF9 Antibody (Biotin)?

The catalog number for IRF9 Antibody (Biotin) is KB-3695.

What sizes are available for IRF9 Antibody (Biotin)?

IRF9 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IRF9 Antibody (Biotin) come in?

IRF9 Antibody (Biotin) is available in 3 different pack sizes.

Is IRF9 Antibody (Biotin) in stock?

IRF9 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.