IRF9 Antibody (Biotin)

Catalog number KB-3671-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3671-01

Size / count 50 μL

Specifications

Catalog number: KB-3671-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon regulatory factor 9, IRF-9, IFN-alpha-responsive transcription factor subunit, ISGF3 p48 subunit, Interferon-stimulated gene factor 3 gamma, ISGF-3 gamma, Transcriptional regulator ISGF3 subunit gamma
Gene Name: IRF9
Gene ID: 10379
UniProt: Q00978
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IRF9
Target: PP-2126
Partner Proteins: Interferon regulatory factor 9; IRF-9; IFN-alpha-responsive transcription factor subunit; ISGF3 p48 subunit; Interferon-stimulated gene factor 3 gamma; ISGF-3 gamma; Transcriptional regulator ISGF3 subunit gamma
Clone: K70047_9B8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 33%, Pig - 73%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: REDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ISGF3G
Target Alternative Name: IRF9
Panel Description: DNA binding & Chromatin, Ferroptosis, Transcription Factors
Host or Source: Mouse
Protein Name: Interferon regulatory factor 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for IRF9 Antibody (Biotin)?

The catalog number for IRF9 Antibody (Biotin) is KB-3671.

What sizes are available for IRF9 Antibody (Biotin)?

IRF9 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IRF9 Antibody (Biotin) come in?

IRF9 Antibody (Biotin) is available in 3 different pack sizes.

Is IRF9 Antibody (Biotin) in stock?

IRF9 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.