TMPRSS15 Antibody (Biotin)

Catalog number KB-3653-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3653-01

Size / count 50 μL

Specifications

Catalog number: KB-3653-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Enteropeptidase, Enterokinase, Serine protease 7, Transmembrane protease serine 15) [Cleaved into: Enteropeptidase non-catalytic heavy chain, Enteropeptidase catalytic light chain]
Gene Name: TMPRSS15
Gene ID: 5651
UniProt: P98073
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TMPRSS15
Target: P01909PAD
Partner Proteins: Enteropeptidase; Enterokinase; Serine protease 7; Transmembrane protease serine 15) [Cleaved into: Enteropeptidase non-catalytic heavy chain; Enteropeptidase catalytic light chain]
Clone: K94058_12H10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 74%, Rat - 32%, Pig - 85%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: LTGSSGSFQATHYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETNPGTIRIFSNQVTATFLIESDESDYVGFNATYTAFNSSELNNYEKINCNFEDGFCFWVQDLNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFNAFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSSTNFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWTTQISNDVCQLLGLGSGNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 74%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ENTK; PRSS7
Target Alternative Name: TMPRSS15
Host or Source: Mouse
Protein Name: Transmembrane serine protease 15
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for TMPRSS15 Antibody (Biotin)?

The catalog number for TMPRSS15 Antibody (Biotin) is KB-3653.

What sizes are available for TMPRSS15 Antibody (Biotin)?

TMPRSS15 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TMPRSS15 Antibody (Biotin) come in?

TMPRSS15 Antibody (Biotin) is available in 3 different pack sizes.

Is TMPRSS15 Antibody (Biotin) in stock?

TMPRSS15 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products