NTHL1 Antibody (Biotin)

Catalog number KB-7489-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7489-01

Size / count 50 μL

Specifications

Catalog number: KB-7489-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Endonuclease III-like protein 1, hNTH1, Bifunctional DNA N-glycosylase/DNA- (apurinic or apyrimidinic site) lyase, DNA glycosylase/AP lyase
Gene Name: NTHL1
Gene ID: 4913
UniProt: P78549
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NTHL1
Target: PP-3240
Partner Proteins: Endonuclease III-like protein 1; hNTH1; Bifunctional DNA N-glycosylase/DNA- (apurinic or apyrimidinic site) lyase; DNA glycosylase/AP lyase
Clone: K29067_11G9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Pig - 70%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: SHSPVKRPRKAQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NTH1; OCTS3
Target Alternative Name: NTHL1
Host or Source: Mouse
Protein Name: Nth like DNA glycosylase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for NTHL1 Antibody (Biotin)?

The catalog number for NTHL1 Antibody (Biotin) is KB-7489.

What sizes are available for NTHL1 Antibody (Biotin)?

NTHL1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does NTHL1 Antibody (Biotin) come in?

NTHL1 Antibody (Biotin) is available in 3 different pack sizes.

Is NTHL1 Antibody (Biotin) in stock?

NTHL1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.