SRPK2 Antibody (Biotin)

Catalog number KB-1403-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1403-01

Size / count 50 μL

Specifications

Catalog number: KB-1403-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: SRSF protein kinase 2, SFRS protein kinase 2, Serine/arginine-rich protein-specific kinase 2, SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal, SRSF protein kinase 2 C-terminal]
Gene Name: SRPK2
Gene ID: 6733
UniProt: P78362
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SRPK2
Target: PP-3322
Partner Proteins: SRSF protein kinase 2; SFRS protein kinase 2; Serine/arginine-rich protein-specific kinase 2; SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal]
Clone: K29040_13D8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 89%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SRPK2
Host or Source: Mouse
Protein Name: SRSF protein kinase 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SRPK2 Antibody (Biotin)?

The catalog number for SRPK2 Antibody (Biotin) is KB-1403.

What sizes are available for SRPK2 Antibody (Biotin)?

SRPK2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SRPK2 Antibody (Biotin) come in?

SRPK2 Antibody (Biotin) is available in 3 different pack sizes.

Is SRPK2 Antibody (Biotin) in stock?

SRPK2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.