EIF5A Antibody (Biotin)

Catalog number KB-3525-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3525-01

Size / count 50 μL

Specifications

Catalog number: KB-3525-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Eukaryotic translation initiation factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic initiation factor 5A isoform 1, eIF-5A, Rev-binding factor, eIF-4D
Gene Name: EIF5A
Gene ID: 1984
UniProt: P63241
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human EIF5A
Target: PP-1279
Partner Proteins: Eukaryotic translation initiation factor 5A-1; eIF-5A-1; eIF-5A1; Eukaryotic initiation factor 5A isoform 1; eIF-5A; Rev-binding factor; eIF-4D
Clone: K56021_20G8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: HGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: EIF5A
Host or Source: Mouse
Protein Name: Eukaryotic translation initiation factor 5A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for EIF5A Antibody (Biotin)?

The catalog number for EIF5A Antibody (Biotin) is KB-3525.

What sizes are available for EIF5A Antibody (Biotin)?

EIF5A Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does EIF5A Antibody (Biotin) come in?

EIF5A Antibody (Biotin) is available in 3 different pack sizes.

Is EIF5A Antibody (Biotin) in stock?

EIF5A Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.