RAP1A Antibody (Biotin)

Catalog number KB-7760-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7760-01

Size / count 50 μL

Specifications

Catalog number: KB-7760-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ras-related protein Rap-1A, C21KG, G-22K, GTP-binding protein smg p21A, Ras-related protein Krev-1
Gene Name: RAP1A
Gene ID: 5906
UniProt: P62834
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RAP1A
Target: PP-813
Partner Proteins: Ras-related protein Rap-1A; C21KG; G-22K; GTP-binding protein smg p21A; Ras-related protein Krev-1
Clone: K56021_3C12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KREV1
Target Alternative Name: RAP1A
Host or Source: Mouse
Protein Name: RAP1A, member of RAS oncogene family, RAP1A, member of RAS oncogene family
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RAP1A Antibody (Biotin)?

The catalog number for RAP1A Antibody (Biotin) is KB-7760.

What sizes are available for RAP1A Antibody (Biotin)?

RAP1A Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RAP1A Antibody (Biotin) come in?

RAP1A Antibody (Biotin) is available in 3 different pack sizes.

Is RAP1A Antibody (Biotin) in stock?

RAP1A Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products