Recombinant SNX16 Antibody

Catalog number RN-12244-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-12244-01

Size / count 50 μL

Specifications

Catalog number: RN-12244-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sorting nexin-16
Gene Name: SNX16
Gene ID: 64089
UniProt: P57768
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SNX16
Target: PP-7321
Partner Proteins: Sorting nexin-16
Clone: K8U051_5H5
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 90%, Pig - 94%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
IHC Dilution: 1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SNX16
Host or Source: Mouse
Protein Name: Sorting nexin 16
IHC description: Succeed
IP description: Fail (HEK-293)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SNX16 Antibody?

The catalog number for Recombinant SNX16 Antibody is RN-12244.

What sizes are available for Recombinant SNX16 Antibody?

Recombinant SNX16 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SNX16 Antibody come in?

Recombinant SNX16 Antibody is available in 3 different pack sizes.

Is Recombinant SNX16 Antibody in stock?

Recombinant SNX16 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.