Caspase-9 Antibody

Catalog number KC-28569-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-28569-01

Size / count 50 μL

Specifications

Catalog number: KC-28569-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-9, CASP-9, Apoptotic protease Mch-6, Apoptotic protease-activating factor 3, APAF-3, ICE-like apoptotic protease 6, ICE-LAP6) [Cleaved into: Caspase-9 subunit p35, Caspase-9 subunit p10]
Gene Name: CASP9
Gene ID: 842
UniProt: P55211
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP9
Target: PP-1710
Partner Proteins: Caspase-9; CASP-9; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3; ICE-like apoptotic protease 6; ICE-LAP6) [Cleaved into: Caspase-9 subunit p35; Caspase-9 subunit p10]
Clone: K29082_9G10
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Pig - 63%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MCH6
Target Alternative Name: Caspase-9
Host or Source: Mouse
Protein Name: Caspase 9
WB Description: Succeed
IHC description: Fail (Testis)
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Caspase-9 Antibody?

The catalog number for Caspase-9 Antibody is KC-28569.

What sizes are available for Caspase-9 Antibody?

Caspase-9 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-9 Antibody come in?

Caspase-9 Antibody is available in 3 different pack sizes.

Is Caspase-9 Antibody in stock?

Caspase-9 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

All Products