Caspase-9 Antibody (Biotin)

Catalog number KB-28201-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-28201-01

Size / count 50 μL

Specifications

Catalog number: KB-28201-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-9, CASP-9, Apoptotic protease Mch-6, Apoptotic protease-activating factor 3, APAF-3, ICE-like apoptotic protease 6, ICE-LAP6) [Cleaved into: Caspase-9 subunit p35, Caspase-9 subunit p10]
Gene Name: CASP9
Gene ID: 842
UniProt: P55211
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP9
Target: PP-1710
Partner Proteins: Caspase-9; CASP-9; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3; ICE-like apoptotic protease 6; ICE-LAP6) [Cleaved into: Caspase-9 subunit p35; Caspase-9 subunit p10]
Clone: K29082_16E9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Pig - 63%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: MCH6
Target Alternative Name: Caspase-9
Host or Source: Mouse
Protein Name: Caspase 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Caspase-9 Antibody (Biotin)?

The catalog number for Caspase-9 Antibody (Biotin) is KB-28201.

What sizes are available for Caspase-9 Antibody (Biotin)?

Caspase-9 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-9 Antibody (Biotin) come in?

Caspase-9 Antibody (Biotin) is available in 3 different pack sizes.

Is Caspase-9 Antibody (Biotin) in stock?

Caspase-9 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

All Products