Caspase-9 Antibody

Catalog number KC-27556-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-27556-01

Size / count 50 μL

Specifications

Catalog number: KC-27556-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-9, CASP-9, Apoptotic protease Mch-6, Apoptotic protease-activating factor 3, APAF-3, ICE-like apoptotic protease 6, ICE-LAP6) [Cleaved into: Caspase-9 subunit p35, Caspase-9 subunit p10]
Gene Name: CASP9
Gene ID: 842
UniProt: P55211
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP9
Target: PP-1710
Partner Proteins: Caspase-9; CASP-9; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3; ICE-like apoptotic protease 6; ICE-LAP6) [Cleaved into: Caspase-9 subunit p35; Caspase-9 subunit p10]
Clone: K29082_16F1
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Pig - 63%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MCH6
Target Alternative Name: Caspase-9
Host or Source: Mouse
Protein Name: Caspase 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Caspase-9 Antibody?

The catalog number for Caspase-9 Antibody is KC-27556.

What sizes are available for Caspase-9 Antibody?

Caspase-9 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-9 Antibody come in?

Caspase-9 Antibody is available in 3 different pack sizes.

Is Caspase-9 Antibody in stock?

Caspase-9 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

All Products