SLURP1 Antibody (Biotin)

Catalog number KB-8336-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8336-01

Size / count 50 μL

Specifications

Catalog number: KB-8336-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Secreted Ly-6/uPAR-related protein 1, SLURP-1, ARS component B, ARS (component B) -81/S, Anti-neoplastic urinary protein, ANUP
Gene Name: SLURP1
Gene ID: 57152
UniProt: P55000
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SLURP1
Target: PQ-167
Partner Proteins: Secreted Ly-6/uPAR-related protein 1; SLURP-1; ARS component B; ARS (component B) -81/S; Anti-neoplastic urinary protein; ANUP
Clone: K70043_18G6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 67%, Pig - 69%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 67%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ARS
Target Alternative Name: SLURP1
Host or Source: Mouse
Protein Name: Secreted LY6/PLAUR domain containing 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SLURP1 Antibody (Biotin)?

The catalog number for SLURP1 Antibody (Biotin) is KB-8336.

What sizes are available for SLURP1 Antibody (Biotin)?

SLURP1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SLURP1 Antibody (Biotin) come in?

SLURP1 Antibody (Biotin) is available in 3 different pack sizes.

Is SLURP1 Antibody (Biotin) in stock?

SLURP1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products