PLAAT3 Antibody (Biotin)

Catalog number KB-8194-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8194-01

Size / count 50 μL

Specifications

Catalog number: KB-8194-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phospholipase A and acyltransferase 3, Adipose-specific phospholipase A2, AdPLA, Group XVI phospholipase A1/A2, H-rev 107 protein homolog, H-REV107, HREV107-1, HRAS-like suppressor 1, HRAS-like suppressor 3, HRSL3, HREV107-3, Renal carcinoma antigen NY-REN-65
Gene Name: PLAAT3
Gene ID: 11145
UniProt: P53816
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PLAAT3
Target: PP-3393
Partner Proteins: Phospholipase A and acyltransferase 3; Adipose-specific phospholipase A2; AdPLA; Group XVI phospholipase A1/A2; H-rev 107 protein homolog; H-REV107; HREV107-1; HRAS-like suppressor 1; HRAS-like suppressor 3; HRSL3; HREV107-3; Renal carcinoma antigen NY-REN-65
Clone: K16304_18G12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 88%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: YRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: HRASLS3; HREV107; PLA2G16
Target Alternative Name: PLAAT3
Host or Source: Mouse
Protein Name: Phospholipase A and acyltransferase 3
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for PLAAT3 Antibody (Biotin)?

The catalog number for PLAAT3 Antibody (Biotin) is KB-8194.

What sizes are available for PLAAT3 Antibody (Biotin)?

PLAAT3 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PLAAT3 Antibody (Biotin) come in?

PLAAT3 Antibody (Biotin) is available in 3 different pack sizes.

Is PLAAT3 Antibody (Biotin) in stock?

PLAAT3 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

All Products