ACLY Antibody (Biotin)

Catalog number KB-30145-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-30145-01

Size / count 50 μL

Specifications

Catalog number: KB-30145-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: ATP-citrate synthase, ATP-citrate, pro-S-) -lyase, ACL, Citrate cleavage enzyme
Gene Name: ACLY
Gene ID: 47
UniProt: P53396
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ACLY
Target: PP-4913
Partner Proteins: ATP-citrate synthase; ATP-citrate; pro-S-) -lyase; ACL; Citrate cleavage enzyme
Clone: K8U043_1D6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: GKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ACLY
Host or Source: Mouse
Protein Name: ATP citrate lyase
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for ACLY Antibody (Biotin)?

The catalog number for ACLY Antibody (Biotin) is KB-30145.

What sizes are available for ACLY Antibody (Biotin)?

ACLY Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ACLY Antibody (Biotin) come in?

ACLY Antibody (Biotin) is available in 3 different pack sizes.

Is ACLY Antibody (Biotin) in stock?

ACLY Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products