Stanniocalcin-1 Antibody

Catalog number KC-27107-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-27107-01

Size / count 50 μL

Specifications

Catalog number: KC-27107-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Stanniocalcin-1, STC-1
Gene Name: STC1
Gene ID: 6781
UniProt: P52823
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human STC1
Target: PQ-235
Partner Proteins: Stanniocalcin-1; STC-1
Clone: K94066_13E6
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 93%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: VAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: STC
Target Alternative Name: Stanniocalcin-1
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Stanniocalcin 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Stanniocalcin-1 Antibody?

The catalog number for Stanniocalcin-1 Antibody is KC-27107.

What sizes are available for Stanniocalcin-1 Antibody?

Stanniocalcin-1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Stanniocalcin-1 Antibody come in?

Stanniocalcin-1 Antibody is available in 3 different pack sizes.

Is Stanniocalcin-1 Antibody in stock?

Stanniocalcin-1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products