Stanniocalcin-1 Antibody

Catalog number KC-27096-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-27096-01

Size / count 50 μL

Specifications

Catalog number: KC-27096-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Stanniocalcin-1, STC-1
Gene Name: STC1
Gene ID: 6781
UniProt: P52823
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human STC1
Target: PQ-235
Partner Proteins: Stanniocalcin-1; STC-1
Clone: K94066_20G1
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 93%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: VAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: STC
Target Alternative Name: Stanniocalcin-1
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Stanniocalcin 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Stanniocalcin-1 Antibody?

The catalog number for Stanniocalcin-1 Antibody is KC-27096.

What sizes are available for Stanniocalcin-1 Antibody?

Stanniocalcin-1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Stanniocalcin-1 Antibody come in?

Stanniocalcin-1 Antibody is available in 3 different pack sizes.

Is Stanniocalcin-1 Antibody in stock?

Stanniocalcin-1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.