ANXA11 Antibody (Biotin)

Catalog number KB-7520-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7520-01

Size / count 50 μL

Specifications

Catalog number: KB-7520-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Annexin A11, 56 kDa autoantigen, Annexin XI, Annexin-11, Calcyclin-associated annexin 50, CAP-50
Gene Name: ANXA11
Gene ID: 311
UniProt: P50995
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANXA11
Target: PP-308
Partner Proteins: Annexin A11; 56 kDa autoantigen; Annexin XI; Annexin-11; Calcyclin-associated annexin 50; CAP-50
Clone: K06358_13G11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 57%, Pig - 93%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: DEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGEN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ANX11
Target Alternative Name: ANXA11
Panel Description: Neurodegenerative Diseases Marker, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Annexin A11
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for ANXA11 Antibody (Biotin)?

The catalog number for ANXA11 Antibody (Biotin) is KB-7520.

What sizes are available for ANXA11 Antibody (Biotin)?

ANXA11 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ANXA11 Antibody (Biotin) come in?

ANXA11 Antibody (Biotin) is available in 3 different pack sizes.

Is ANXA11 Antibody (Biotin) in stock?

ANXA11 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.