SERPINB8 Antibody (Biotin)

Catalog number KB-8037-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8037-01

Size / count 50 μL

Specifications

Catalog number: KB-8037-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Serpin B8, Cytoplasmic antiproteinase 2, CAP-2, CAP2, Peptidase inhibitor 8, PI-8
Gene Name: SERPINB8
Gene ID: 5271
UniProt: P50452
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SERPINB8
Target: PP-803
Partner Proteins: Serpin B8; Cytoplasmic antiproteinase 2; CAP-2; CAP2; Peptidase inhibitor 8; PI-8
Clone: K40067_14E9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 83%, Rat - 49%, Pig - 90%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: LPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 83%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: PI8
Target Alternative Name: SERPINB8
Host or Source: Mouse
Protein Name: Serpin family B member 8
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SERPINB8 Antibody (Biotin)?

The catalog number for SERPINB8 Antibody (Biotin) is KB-8037.

What sizes are available for SERPINB8 Antibody (Biotin)?

SERPINB8 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SERPINB8 Antibody (Biotin) come in?

SERPINB8 Antibody (Biotin) is available in 3 different pack sizes.

Is SERPINB8 Antibody (Biotin) in stock?

SERPINB8 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

All Products