SDF1 Antibody (Biotin)

Catalog number KB-1712-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1712-01

Size / count 50 μL

Specifications

Catalog number: KB-1712-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Stromal cell-derived factor 1, SDF-1, hSDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, IRH, hIRH, Pre-B cell growth-stimulating factor, PBSF) [Cleaved into: SDF-1-beta (3-72, SDF-1-alpha (3-67]
Gene Name: CXCL12
Gene ID: 6387
UniProt: P48061
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CXCL12
Target: PP-3056
Partner Proteins: Stromal cell-derived factor 1; SDF-1; hSDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH; Pre-B cell growth-stimulating factor; PBSF) [Cleaved into: SDF-1-beta (3-72; SDF-1-alpha (3-67]
Clone: K92033_5D11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Pig - 97%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: SDF1; SDF1A; SDF1B
Target Alternative Name: SDF1
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: C-X-C motif chemokine ligand 12
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for SDF1 Antibody (Biotin)?

The catalog number for SDF1 Antibody (Biotin) is KB-1712.

What sizes are available for SDF1 Antibody (Biotin)?

SDF1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SDF1 Antibody (Biotin) come in?

SDF1 Antibody (Biotin) is available in 3 different pack sizes.

Is SDF1 Antibody (Biotin) in stock?

SDF1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.