XCL1 Antibody (Biotin)

Catalog number KB-8295-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8295-01

Size / count 50 μL

Specifications

Catalog number: KB-8295-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lymphotactin, ATAC, C motif chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1, XC chemokine ligand 1
Gene Name: XCL1
Gene ID: 6375
UniProt: P47992
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human XCL1
Target: PP-1237
Partner Proteins: Lymphotactin; ATAC; C motif chemokine 1; Cytokine SCM-1; Lymphotaxin; SCM-1-alpha; Small-inducible cytokine C1; XC chemokine ligand 1
Clone: K40033_14E11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 57%, Pig - 70%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: LTN; SCYC1
Target Alternative Name: XCL1
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: X-C motif chemokine ligand 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for XCL1 Antibody (Biotin)?

The catalog number for XCL1 Antibody (Biotin) is KB-8295.

What sizes are available for XCL1 Antibody (Biotin)?

XCL1 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does XCL1 Antibody (Biotin) come in?

XCL1 Antibody (Biotin) is available in 3 different pack sizes.

Is XCL1 Antibody (Biotin) in stock?

XCL1 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

All Products