Recombinant CTSO Antibody (Biotin)

Catalog number RB-14454-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RB-14454-01

Size / count 50 μL

Specifications

Catalog number: RB-14454-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cathepsin O
Gene Name: CTSO
Gene ID: 1519
UniProt: P43234
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CTSO
Target: PP-11239
Partner Proteins: Cathepsin O
Clone: K06376_2D12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 66%, Rat - 37%, Pig - 88%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 66%
Recombinant Antibody: Yes
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CTSO1
Target Alternative Name: CTSO
Host or Source: Mouse
Protein Name: Cathepsin O
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CTSO Antibody (Biotin)?

The catalog number for Recombinant CTSO Antibody (Biotin) is RB-14454.

What sizes are available for Recombinant CTSO Antibody (Biotin)?

Recombinant CTSO Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CTSO Antibody (Biotin) come in?

Recombinant CTSO Antibody (Biotin) is available in 3 different pack sizes.

Is Recombinant CTSO Antibody (Biotin) in stock?

Recombinant CTSO Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.