LIFR Antibody (Biotin)

Catalog number KB-8357-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8357-01

Size / count 50 μL

Specifications

Catalog number: KB-8357-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Leukemia inhibitory factor receptor, LIF receptor, LIF-R, CD antigen CD118
Gene Name: LIFR
Gene ID: 3977
UniProt: P42702
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LIFR
Target Antigen: CD118
Target: PP-796
Partner Proteins: Leukemia inhibitory factor receptor; LIF receptor; LIF-R; CD antigen CD118
Clone: K16275_20C3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 82%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: YQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEEDLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: LIFR
Panel Description: CD Antigen, Ferroptosis
Host or Source: Mouse
Protein Name: LIF receptor subunit alpha
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for LIFR Antibody (Biotin)?

The catalog number for LIFR Antibody (Biotin) is KB-8357.

What sizes are available for LIFR Antibody (Biotin)?

LIFR Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LIFR Antibody (Biotin) come in?

LIFR Antibody (Biotin) is available in 3 different pack sizes.

Is LIFR Antibody (Biotin) in stock?

LIFR Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.