BCL6 Antibody (Biotin)

Catalog number KB-3681-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3681-01

Size / count 50 μL

Specifications

Catalog number: KB-3681-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: B-cell lymphoma 6 protein, BCL-6, B-cell lymphoma 5 protein, BCL-5, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51
Gene Name: BCL6
Gene ID: 604
UniProt: P41182
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BCL6
Target: PP-10552
Partner Proteins: B-cell lymphoma 6 protein; BCL-6; B-cell lymphoma 5 protein; BCL-5; Protein LAZ-3; Zinc finger and BTB domain-containing protein 27; Zinc finger protein 51
Clone: K1E024_1F5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAEL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: BCL5; LAZ3; ZBTB27; ZNF51
Target Alternative Name: BCL6
Panel Description: IHC Pathology, Ferroptosis, Transcription Factors, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: BCL6 transcription repressor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for BCL6 Antibody (Biotin)?

The catalog number for BCL6 Antibody (Biotin) is KB-3681.

What sizes are available for BCL6 Antibody (Biotin)?

BCL6 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does BCL6 Antibody (Biotin) come in?

BCL6 Antibody (Biotin) is available in 3 different pack sizes.

Is BCL6 Antibody (Biotin) in stock?

BCL6 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products