BCL6 Antibody (Biotin)

Catalog number KB-1099-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1099-01

Size / count 50 μL

Specifications

Catalog number: KB-1099-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: B-cell lymphoma 6 protein, BCL-6, B-cell lymphoma 5 protein, BCL-5, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51
Gene Name: BCL6
Gene ID: 604
UniProt: P41182
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BCL6
Target: PP-10552
Partner Proteins: B-cell lymphoma 6 protein; BCL-6; B-cell lymphoma 5 protein; BCL-5; Protein LAZ-3; Zinc finger and BTB domain-containing protein 27; Zinc finger protein 51
Clone: K1E024_3B12
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAEL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: BCL5; LAZ3; ZBTB27; ZNF51
Target Alternative Name: BCL6
Panel Description: IHC Pathology, Ferroptosis, Transcription Factors, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: BCL6 transcription repressor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for BCL6 Antibody (Biotin)?

The catalog number for BCL6 Antibody (Biotin) is KB-1099.

What sizes are available for BCL6 Antibody (Biotin)?

BCL6 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does BCL6 Antibody (Biotin) come in?

BCL6 Antibody (Biotin) is available in 3 different pack sizes.

Is BCL6 Antibody (Biotin) in stock?

BCL6 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

All Products