IL15 Antibody (Biotin)

Catalog number KB-831-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-831-01

Size / count 50 μL

Specifications

Catalog number: KB-831-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-15, IL-15
Gene Name: IL15
Gene ID: 3600
UniProt: P40933
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL-15, Recombinant human IL15
Target: PP-792
Partner Proteins: Interleukin-15; IL-15
Clone: K94008_7D11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 70%, Rat - 70%, Pig - 79%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 70%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: IL15
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Interleukin 15
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for IL15 Antibody (Biotin)?

The catalog number for IL15 Antibody (Biotin) is KB-831.

What sizes are available for IL15 Antibody (Biotin)?

IL15 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL15 Antibody (Biotin) come in?

IL15 Antibody (Biotin) is available in 3 different pack sizes.

Is IL15 Antibody (Biotin) in stock?

IL15 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

All Products