Actin Regulatory Protein CAPG Antibody

Catalog number KC-11542-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-11542-01

Size / count 50 μL

Specifications

Catalog number: KC-11542-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Macrophage-capping protein, Actin regulatory protein CAP-G
Gene Name: CAPG
Gene ID: 822
UniProt: P40121
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CAPG
Target: PP-1092
Partner Proteins: Macrophage-capping protein; Actin regulatory protein CAP-G
Clone: K56015_14H4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: RDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AFCP; MCP
Target Alternative Name: Actin Regulatory Protein CAPG
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Capping actin protein, gelsolin like
IHC description: Succeed
IP description: Fail (THP-1)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Actin Regulatory Protein CAPG Antibody?

The catalog number for Actin Regulatory Protein CAPG Antibody is KC-11542.

What sizes are available for Actin Regulatory Protein CAPG Antibody?

Actin Regulatory Protein CAPG Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Actin Regulatory Protein CAPG Antibody come in?

Actin Regulatory Protein CAPG Antibody is available in 3 different pack sizes.

Is Actin Regulatory Protein CAPG Antibody in stock?

Actin Regulatory Protein CAPG Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.