GDNF Antibody (Biotin)

Catalog number KB-12071-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-12071-01

Size / count 50 μL

Specifications

Catalog number: KB-12071-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Glial cell line-derived neurotrophic factor, hGDNF, Astrocyte-derived trophic factor, ATF
Gene Name: GDNF
Gene ID: 2668
UniProt: P39905
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GDNF
Target: PP-1550
Partner Proteins: Glial cell line-derived neurotrophic factor; hGDNF; Astrocyte-derived trophic factor; ATF
Clone: K92005_19F6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 94%, Pig - 92%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: GDNF
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Glial cell derived neurotrophic factor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for GDNF Antibody (Biotin)?

The catalog number for GDNF Antibody (Biotin) is KB-12071.

What sizes are available for GDNF Antibody (Biotin)?

GDNF Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GDNF Antibody (Biotin) come in?

GDNF Antibody (Biotin) is available in 3 different pack sizes.

Is GDNF Antibody (Biotin) in stock?

GDNF Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.